SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

bigdogsporch.com
Title: Big Dogs Porch Forums - Message Boards, Chat & Info for Large and Giant Breeds
Description: Forums for big dog lovers, dog and breed information, live chat and gift shop

Site: "bigdogsporch.com"
IP Address: 74.52.105.50
IP Location: United States

This site within Alpha Directory: i ig


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Animalden.com: Pet Gifts & Jewelry for Animal Lovers-Gifts for Pets & Animals-Animal Den

Pet Gifts & Jewelry for Animal Lovers - Gifts for Pets & Animals – Unique Pet Apparel of the highest quality and variety – Check out our extensive collection of pet gift ideas.
Keywords: animal den; bird collectibles; bird figurines; gray cat; deer pin; cat gift; animal lovers; cat figurine; owl earrings; collectibles birds;

Anwo.com: Animal World Plush Stuffed Animals, Throw Blankets, Crossing Signs, Figurines, T Shirts, Toy Animals, Puppets, Figurines, Earrings, Gifts.

Animal World at Anwo.com features Gifts for Animal, Dog, Horse, Cat, Dinosaur Lovers, throw blankets, crossing signs, plush, stuffed animals, figurines, puppets, t shirts, cookie jars, earrings, pillows, toys, neckties, mugs, keychains, calendars, in over 500 different animal and pet lover themes.
Keywords: animal world; crossing sign; dog plush; animals toys; plush dog; toy animals; horse figurine; dog blanket; tiger figurine; dog stuffed animals;

Babarker.com: Dog Gifts and Accessories

Dog gifts and Dog Accessories for the Dog Lover in all of us. Over 850 unique dog gifts and accessories. Specializing in dog gifts by breed, over 60 breeds available, including Golden Retriever, Lab, Dachshund, Pug, Westie, and Yorkie.
Keywords: dog gifts; german shepherd gifts; yorkie gifts; pug gifts; gifts for dog lovers; golden retriever gifts; dog lover; shih tzu gifts; schnauzer gifts; dog lovers;

Cafepress.com: Custom T-Shirts, Unique Gifts, Posters, & Personalized Mugs | CafePress

CafePress has the best selection of custom t-shirts, personalized gifts, posters & art, mugs, and much more. Get your unique or funny gift, t shirt, or other cool promotional merchandise for any occasion. High quality. 24 hour shipping available.
Keywords: cafe press; cafepress; cafepress.com; cafepress com; t-shirts; cafe; t shirt; t shirts; diario clarin; e online;

Dogshoppe.net: DogShoppe.net | Unique Dog Breed Specific Gifts for Dog Lovers

Dogshoppe.net offers Dog Breed Merchandise, Gifts and Collectibles including dog flags, business card holders, totes, embroidered clothing, leash holders, cross stitch, license plates, coasters, ornaments, signs, jewelry, luggage tags and accessories. Beautiful dog breed gifts for any dog lover.
Keywords: rhodesian ridgeback merchandise; unique dog gifts; dog breed gifts; french bulldog gifts; dog gifts; bichon frise gifts; dog handbags; shih tzu gifts; gifts for dog lovers; unique dog gift;

Petpro.com: PetPro Dog Breed Gifts Merchandise Collectibles & Products

Unique breed dog gifts, collectibles, mechandise and products. including dog calendars, dog flags, dog signs, dog watches, dog jewelry
Keywords: pet gifts; gifts and collectibles; pet pro; pet flags; dog collectibles; pet pros; pet items; dog collectables; dog breed gifts; dog door mat;

Rottweiler-gifts.com: Rottweiler Gifts.com - Rottweiler dog Art, Gifts & Collectibles

Online shopping guide for Rottweiler dog lovers. Art, cards, gifts and collectibles; more than 1,000 Rottweiler gift ideas, presented in 14 product categories. Rottie dogs rule on this website!
Keywords: rottweiler gifts; pug art; pug calendar; rottweiler art; figurines sculptures; pug calendars; pug flag; rottweiler statue; rottweiler collectibles; rottweiler gift;

Yuckles.com: YUCKLES! Silly as we wanna be!

Family friendly animal humor and original fun pages. Virtual barnyard has dancing pigs, cloned sheep, dog haiku, singing cats and much more!
Keywords: cat sounds; cat christmas cards; happy halloween; chihuahua gifts; miami postcards; chihuahua collectibles; dog ornaments; cat ornaments; dog christmas cards; yorkshire terrier gifts;

Zazzle.com: Zazzle | Custom T-Shirts, Personalized Gifts, Posters, Art, and more

Shop Millions of Art Products
Keywords: zazzle; shirts; pink polo shirts; business cards; t-shirts; t shirts; zazzle.com; posters; stickers; mugs;
 1 
Other top sites:   chappellfarms.com     crohnsite.be     occopwatch.newsvine.com     pafamilylaw.com     caminfo.co.uk     animation.dreamworksfansite.com   
Recently processed sites:   bestmaytagdishwasherreviews.info     bestmaytagquietseries100parts.blogspot.com     bestmazdaparts.com     bestmaze.com     bestmbacolleges.blogspot.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9