SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

mbhp.org
Title: mbhp - Metropolitan Boston Housing Partnership
Description: At Metropolitan Boston Housing Partnership, we help individuals and families to find and retain affordable housing. We are the state’s largest regional provider of rental voucher assistance, serving homeless, elderly, disabled, and low- and moderate-income residents of Boston and 29 surrounding communities.

Site: "mbhp.org"
IP Address: 66.113.131.41
IP Location: United States

This site within Alpha Directory: b bh


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Apartmentguide.com: Apartments for Rent and Rentals - Free Apartment Finder | ApartmentGuide.com

Keywords: apartments; apartment; apartments for rent; rent; apartment guide; dublin apartments; apartment rental; apartment finder; luxury apartments; rent apartment;

Apartmentlist.com: Default Parallels Plesk Panel Page

Keywords: summerwood apartments utah;

Apartments.com: Apartments.com | Rent an Apartment, Houses, Condos or Townhomes ...

Find and rent apartments, houses, condos and townhomes. View floor plans, photos and 360-degree views.
Keywords: apartments; apartment; apartments for rent; apartment for rent; rent; rental apartments; rentals; san diego ca housing; apartments.com; apartments com;

Forrent.com: Apartments for Rent | An Apartment Finder & Guide for Rentals - ForRent.com

Apartments for Rent | An Apartment Finder & Guide for Rentals | ForRent.com provides a customized search from thousands of apartment listings nationwide
Keywords: apartments; for rent; rent; apartments for rent; apartment; for rent; apartments for rent; rent com; apartment for rent; for rent london;

Padmapper.com: PadMapper - Free Map-Based Craigslist Apartment Search

A free tool to help you find an apartment. Basically, it's a big Google map with tons of Craigslist apartment listings marked on it.
Keywords: google map search; apartment search; pad mapper; sackville apartments; eastbrook bathrooms; cheapest utilities; 1500 baths; colville gardens; shaw court apartments; manayunk gardens;

Rentals.com: Rentals.com - Homes for Rent, Apartments, Houses for Rent, Townhomes, Condos & Vacation Rental Properties

Home rentals, homes for rent, apartments, houses for rent, condos, townhomes, apartment rentals, and rental homes. Post your own rental ad or view listings for free.
Keywords: rentals; homes for rent; rental homes; rent; las vegas nv housing; house rentals; rental properties; houses apartments for rent; las vegas nv houses; houses for rent;

Renthop.com: RentHop.com - No Fee NYC Apartment Rentals

No Fee NYC Apartments, search no-fee New York City and Manhattan rental listings for free. We provide full landlord addresses and contact information with ...
Keywords: nyc apartment rentals; nyc apartments; no fee apartments manhattan; no fee rentals nyc; cheap apartments in new york; no broker fee apartments nyc; nyc apt rentals; nyc apartment rental; new york city apartment rentals; apartment rental nyc;

Rentwave.com: rentwave.com - apartments directory

Keywords: apartment listings; apartment real estate; real estate apartment; looking to rent; apartments listings; looking for rent; real estate apartments; apartments houses; los angeles apartment listings; listings apartments;

Zillow.com: Real Estate, Homes for Sale & Real Estate Values - Zillow

Keywords: home for sale; realestate; real estate; houses for sale; los angeles ca homes for sale; zillow; las vegas nv homes for sale; homes for sale; mortgage rates; chicago il homes for sale;
 1 
Other top sites:   graftonchristianunity.com     quaff.org     genevickers.com     thecolosseum.co.za     nysbroadcastersassn.org     altusezra.com   
Recently processed sites:   srikali.org     srikaliswari.com     srikalki.com     srikalogy.com     srikanchimahaswamividyamandir.org   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9