SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form
molanbi.wordpress.com

Site: "molanbi.wordpress.com"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: o ol


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon
Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Abt.com: Abt Electronics And Appliance Store- HDTVs, Refrigerators and More

Free shipping available - Abt.com is a leading retailer of quality consumer electronics and appliances. Our electronics store offers you the ability to shop for all your appliance and electronic product needs in one online store.
Keywords: abt; refrigerators; electronics televisions; bose speakers; abt electronics; audio receiver; dishwashers; trash compactors; televisions; samsung tv;

Amazon.com: Amazon.com: Online Shopping for Electronics, Apparel, Computers, Books ...

Online shopping from the earth's biggest selection of books, magazines, music, DVDs, videos, electronics, computers, software, apparel & accessories, shoes, ...
Keywords: amazon; amazon com; amazon.com; books for sale; porno; corriere della sera; printers; laptop computers; mp3 player; iphone;

Bedbathandbeyond.com:

Keywords: duvet covers; bed bath and beyond; bed; shower curtains; mattress pads; bedding; air purifier; duvet cover; shower heads; sheets;

Chefsresource.com: All Clad Cookware, Gourmet cookware, Cutlery, Shun Knives, Wusthof Knives Global Knives, Le Creuset, and More .
Keywords: cookware kitchen; cutlery kitchen; kitchen cutlery; cutlery; kitchen cookware; global knives; shun knives; rechaud; casserole pan; kitchen furniture;

Goodhousekeeping.com: Diet Plans - Healthy Recipes - Haircut Pictures - Cleaning Tips - Good Housekeeping

Good Housekeeping is the most trusted online source for advice about food, diet, beauty, health, family and home, plus exclusive product reviews from the Good Housekeeping Research Institute.
Keywords: good housekeeping; teeth whitening at home; sweepstakes and contests; good housekeeping magazine; ipod docking stations; ipod docking stations; good housekeeping; good; living room decor; giveaway;

Hsn.com: HSN.com Official Site

Shop new arrivals daily from fantastic brands. Get helpful customer reviews and expert ... Rarities: Fine Jewelry with Carol Brodie. previous. 1. 2. 3. next ...
Keywords: hsn.com; hsn com; home shopping network; hsn.com; hsn.com; home shopping; hsn.com; home shopping network; www hsn com; shopping channel;

Metrokitchen.com: All-Clad Cookware on Sale with Free Shipping from MetroKitchen.com

All-Clad + Free Shipping & Gifts on top brands for the professional chef in each of us including All-Clad, Wusthof, Henckels, Global, and more.
Keywords: all clad; enclume; global knives; all-clad cookware; all clad cookware; wusthof; all clad stainless; global knife; shun knives; wusthof knives;

Overstock.com: Overstock.com: Online Shopping - Bedding, Furniture, Electronics, Jewelry, Clothing & more

Keywords: overstock; overstock.com; women's clothing; televisions; rings; watches; jewelry; tvs; laptop computers; men's watches;

Www1.macys.com: Macy's - Clothing, Shoes, Bed & Bath, Kitchen, Beauty Brands & Sunglasses

Shop online at the world's largest department store; an extraordinary assortment from all the best brands in fashion for him and her, everything for home, cosmetics & fragrances and jewelry.
Keywords: necklaces; men's watches; earrings; michael kors handbags; men's jeans; dooney; duvet covers; window treatments; clinique; sweaters;
 1 
Other top sites:   marcpeterson.name     garbes.kuopa.vaizdelis.lt     casakids.org     geppettos.com     angelique.typepad.com     faithandfreedom.org   
Recently processed sites:   deepcreeklakecabinrental.com     deepcreeklakechalet.com     deepcreeklake.com     deepcreeklakecottage.com     deepcreeklakefamilyactivities.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9