SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form
panopolis.info

Site: "panopolis.info"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: a an


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon
Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
Sample Organic Keywords
university of florida logos
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Digitalworlds.ufl.edu: Digital Worlds Institute
Keywords: digital worlds; digital worlds institute; uf gym;

Ics.ifas.ufl.edu: IFAS Communication Services - Institute of Food and Agricultural ...

Mar 19, 2009 ... The Office of External and Media Relations provides public information, PR, and marketing support services for IFAS and its many units. ...
Keywords: fedex kinkos; fedex kinko's; kinko's; kinko; fedex kinko; kinkos fedex; kinkos com; kinko's fedex; kinkos pricing; fedex contacts;

Identity.ufl.edu: University of Florida Identity
Keywords: university of florida logo; university of florida logos; university of florida colors; university of florida mascot; uf logo; uf logo; university florida logo; university of florida gators logo; monarch size; florida logo;

Sg.ufl.edu: University of Florida Student Government

Keywords: student government; university student; government student; student university; cabinet chairs; student government elections; student legal services; event evaluation; cabinet departments; florida government;

Usfweb2.usf.edu: University of South Florida - A metropolitan Research I university, with 4 campuses located in central Florida.

The University of South Florida, a Research 1 institution with over 35,000 students located in Tampa, Florida.
Keywords: usf; usf.edu; enlace; infomart; university south florida; university of florida tuition; university of florida majors; usf sundome; florida workmans comp insurance; university logos;
 1 
Other top sites:   rockcliffelandscaping.com     hrses.syr.edu     tavernadegliartisti.com     leapfrog-connect.software.informer.com     lhsonline.co.uk     northtexascatrescue.org   
Recently processed sites:   cerwinvegareplacementspeakers.dealcheapoh.com     cerwin-vega.se     cerwin-vega-shop.buycheapr.com     cerwin-vega-speaker.buycheapr.com     cerwinvegaspeakerreplacement.elecworldhub.info   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9