SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

righteouskings.com
Title: Righteous Kings - The Front Page
Description: vBulletin 4.0 Publishing Suite with CMS

Site: "righteouskings.com"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: i ig


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

En.wikipedia.org: Wikipedia, the free encyclopedia

Keywords: facebook; gmail; g m a i l; google; s e x; sex; orkut; you tube; mortgage; orange;

Metacafe.com: Metacafe - Online Video Entertainment - Free video clips for your enjoyment

One of the world's largest video sites, serving the best videos, funniest movies and clips.
Keywords: metacafe; video; videos; hulu; strip poker; funny accidents; mia y miguel; let the bodies hit the floor; strip; video clips;

Online-tech-tips.com: Computer Tips From A Computer Guy

Computer tutorials, technology news, software reviews, and personal computing tips.
Keywords: internet explorer 9; get rid of spyware; computer to tv cable; pc to tv cable; convert pdf to word; google toolbar notifier; dat file; music management software; best free registry cleaner; free registry cleaners;

Ustream.tv: Ustream.tv

Stream a live broadcast, webcam chat rooms or free TV online. Web podcast, free Video Streaming, Live TV show broadcasting and LIVE VIDEO Chat by USTREAM.TV
Keywords: streaming; el universal; diretta; programacion tv; los 40 principales; noticias; diario el pais; streaming online; streaming video; nick jonas;

Vimeo.com: Vimeo, Video Sharing For You

Vimeo is a respectful community of creative people who are passionate about sharing the videos they make. We provide the best tools and highest quality video in the universe.
Keywords: gmail com; vimeo; vuelo; globo; météo; sky; cartel de santa; hi; meebo; meteo;

Youtube.com: YouTube

Upload, tag, and share your videos worldwide on YouTube, and watch other user-submitted videos sorted by most recent, ... hours of video uploaded every ...
Keywords: you tube; google; youtube.com; youtube com; you; www youtube com; www.youtube.com; youtube videos; yotube; david bisbal;
 1 
Other top sites:   weldriteservices.com     optimum-construction-ltd.co.uk     eastside-mini-show.com     hyipstatus.com     softlab.ru     themaryduncanteam.com   
Recently processed sites:   blackfridaydigitalcameraonsale.com     blackfridaydigitalcameraprinterdock.cheapshopsnow.com     blackfridaydigitalcamerasales.info     blackfridaydigitalcamerasales.us     blackfridaydigitalcameras.info   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9