SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form
1st4ukloans.co.uk
Title: Best UK Loans : Compare Personal Loan Deals & Cheap Loans, Low Interest Rate Loans
Description: Compare hundreds of UK loans to find the best personal loan for you and apply online. Finance available for people with a good or poor credit rating.

Site: "1st4ukloans.co.uk"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: s st


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon
Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Cahoot.com: Banking online in the UK from cahoot

Banking online with cahoot is easy, access to your accounts 24 hours a day or use our mobile banking and automated telephone services
Keywords: cahoot; cahoot bank; cahoot savings; cahoot credit card; cahoot co uk; cahoot flexible loan; cahoot banking; cahoot online banking; online bank accounts uk; cahoot uk;

Fairinvestment.co.uk: Fairinvestment.co.uk | Savings, Investments, SIPP, ISAs | Mortgage, Loan and Insurance Comparison.
Keywords: buy to let home insurance; gocompare; esure car insurance; sainsburys bank; norwich union car insurance quote; gocompare; saga home insurance; norwich union car insurance; saga insurance; best fixed rate bonds;

Forums.moneysavingexpert.com: MoneySavingExpert.com Forums

Cut bills without cutting back
Keywords: money saving expert; whiplash payout; moneysavingexpert; john lewis sale; radley messenger bag; wentworth finance; washing machine insurance; john lewis price match; iva forum; asda loans;

Loan.org.uk: Loan

Loan
Keywords: hfc bank loan; abbey loan; abbey loan; abbey national loans; abbey loans; abbey national loans; abbey personal loan; lombard direct loans; abbey loans; abbey loan national;

Moneyextra.com: Compare credit cards, cheap loans, mortgages, savings, car & home insurance cheapest UK deals - moneyextra.com

Looking to save money on personal loans or cheap student loans, UK mortgage rates and deals or why not compare credit cards, savings and accounts
Keywords: privilege insurance; moneyextra; shares online; norwich union car insurance; ftse100 share prices; money extra; loans uk; lloyds tsb loans; individual savings account; share prices uk;

Moneysavingexpert.com: Money Saving Expert: Consumer Revenge - Credit Cards, Shopping, Bank Charges, Cheap Flights and more

Martin Lewis's free site saves you money. Beat the system on credit cards, shopping, special offers, mortgages, council tax, interest rate payments, freebies, loans, loopholes, best buys. Compare, read, discuss and be a Money Expert.
Keywords: money saving expert; cash isas; martin lewis; moneysavingexpert; cash isa; money supermarket; best cash isa; best isa; isa savings; restaurant vouchers;

Thebigchoice.com: graduate jobs - uk student recruitment careers advice TheBigChoice.com

Finding graduate jobs and student recruitment opportunities in the uk is our speciality. Click here for online careers advice, cv writing, ucas information, vacancies and more at TheBigChoice.com
Keywords: graduate jobs uk; graduate careers uk; wanadoo broadband; graduate scheme; london graduate jobs; student credit cards uk; graduate jobs midlands; graduate uk; graduate jobs north west; jobs sainsburys;
 1 
Other top sites:   megan-reads.blogspot.com     heatherkamann.com     haroldhead.com     palaciodatuba.com     farfartravel.com     rainbowl.co.uk   
Recently processed sites:   sunnysidechurchofchrist.com     sunnysidechurch.org     sunnysidechurch.org.uk     sunnysidechurchottawa.com     sunnysideclassicvwcamperrentals.co.uk   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9