SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

allieddatacorprecovery.com
Title: Allied Data Corporation - Professional Collection Agency/Agencies
Description: ... Agency to handle your bad debt accounts receivable, try Allied Data Corporation based out of Houston ... Our agency provides licensed collection services in ...

Site: "allieddatacorprecovery.com"
IP Address: 208.109.239.171
IP Location: United States

This site within Alpha Directory: l ll


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Bbb.org: United States and Canada BBB Consumer and Business Reviews, Reports, Ratings, Complaints and Accredited Business Listings

The Better Business Bureau of the United States and Canada offers consumers and businesses resources including business and charity reviews, complaints, statistics, ratings, and more to assist in intelligent buying decisions and investment opportunities.
Keywords: bbb; better business bureau; better; bureau; give; stauer; auto dealers used; charities; bbb.org; better business bureau canada;

Creditboards.com: CreditBoards.com - Credit Help, Credit Repair Tips, News, Forums

Creditboards.com: Learning how to maximize your credit opportunities; how to repair your credit; how to raise your FICO scores; how to deal with collectors and collection agencies; what your rights are under the FDCPA and FCRA.
Keywords: experian dispute; credit boards; transforming debt into wealth; wfnnb credit cards; cbsd; highest credit score; credit board; wfnnb credit card; orange loan; credit repair forums;

Debtconsolidationcare.com: Debt consolidation community: 115,000+ people already helped for free

Free counseling on debt consolidation, loans, debt settlement, credit card debt, payday loans, etc from our community financial experts Call 800-601-1579
Keywords: debt consolidation; debt settlement; debt help; debt help; debt help; debt management; debt management; debt reduction; credit card consolidation; credit card debt consolidation;

Ripoffreport.com: Ripoff Report: By Consumers, For Consumers

Want justice! The Rip Off Report allows you a central place to enter complaints about companies and individuals who are ripping people off. Our reports cover every category imaginable! Submit your story on our Web site for free, for millions to see. Report everything from Auto Dealers, Retail Stores, to Corrupt City & State Governments, Politicians Police, to Funeral Homes, Senior Citizen Home
Keywords: magic jack; jg wentworth; ashworth university; safelite auto glass; safelite; ripoff report; bb&t bank; scam; rip off; bank of america military;

Yellowpages.com: YellowPages.com

Business phone number directory, searchable by city, state, business name, and type of business. Also includes international yellow pages.
Keywords: yellow pages; orlando fl movers; san antonio tx movers; las vegas nv insurance; miami fl movers; yellowpages; yellowpages com; yellowpages.com; phone; detroit mi movers;
 1 
Other top sites:   wellsborofire.com     mojokawasaki.com     temperformance.com     mariannebennett.com     want2b.eu     learnirishdesmoines.blogspot.com   
Recently processed sites:   simplyperfectweddings.blogspot.com     simplyperfectweddingservices.com     simplyperformance.co.uk     simplypergolas.com     simplyperidot.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9