SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

am-international-agencies.com
Title: AM International Agencies - Welcome to AM International Agencies
Description: The sole UK and Ireland agents and distributors for international suppliers of exclusive dolls, teddy bears, porcelain collections, gifts, toys, doll house miniatures and furniture, collectables and collectibles.

Site: "am-international-agencies.com"
IP Address:
IP Location: Unknown IP



SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Aliexpress.com: Wholesale - Buy Products Online from China Wholesalers at Aliexpress.com

Find Quality Wholesalers, Suppliers, Manufacturers, Buyers and Products from Our Award-Winning International Trade Site. Wholesale Products from China Wholesalers at Aliexpress.com.
Keywords: laptops direct; petrol brush cutter; mobile phones direct; t0715; laptop trolley; lambdasonde; hawaiian fancy dress; fitness lounge; sleigh cot; laptop factory outlet;

Collectorsweekly.com: Best of Antiques, Vintage, Collecting | Collectors Weekly

Browse, research, and explore the world of antiques, vintage, memorabilia, and collecting....
Keywords: porcelain sign; wristwatches; antique lamps; coca cola sign; antique sterling silver; antique wall clock; psych records; antique oil lamps; coke machine; football memorabilia;

Ebay.com: eBay - New & used electronics, cars, apparel, collectibles, sporting goods & more at low prices

Buy and sell electronics, cars, clothing, apparel, collectibles, sporting goods, digital cameras, and everything else on eBay, the world's online marketplace. Sign up and begin to buy and sell - auction or buy it now - almost anything on eBay.com
Keywords: ebay; e-bay; e bay; ebay.com; ebay com; e; bay; www.ebay.com; www ebay com; e bay com;

Epinions.com: Reviews from Epinions

Read Reviews on Digital Cameras, Cars, Books, Movies, Music and More.
Keywords: chase credit card; washing machines; uhaul; gps devices; computer games software; refrigerators; point and shoot digital cameras; juicers; dishwashers; pc laptops;

Flickr.com: Welcome to Flickr - Photo Sharing

Flickr is almost certainly the best online photo management and sharing application in the world. Show off your favorite photos and videos to the world, securely and privately show content to your friends and family, or blog the photos and videos you take with a cameraphone.
Keywords: flickr; fb; flikr; photos; austin tx; tuenti; informatique; flickr.com; yahoo.es; yahoo es;

Krbearsanddolls.com: login

Keywords: gotz sarah doll; bettine klemm; nici wild friends; nici wild friends; groovy girls dreamtastic; groovy girl minis; mariquita model; groovy girl minis; gotz dolls uk; ooak miniature;

Prillycharmin.com: PrillyCharmin Doll Shop, Welcome to PrillyCharmin Dolls!

PrillyCharmins Doll Shop for dolls, doll supplies, closeouts, bargains and beautiful vintage dolls.
Keywords: prilly; reborn doll; how to reborn dolls; doll eyelashes; reborn doll instructions; reborn dolls how to; doll restoration; vintage vinyl doll; saucy doll; fiestaware tea set;

Sylvianatterer.com: Sylvia Natterer Dolls

Keywords: natterer; white balloon dolls; sylvia natterer dolls; white balloon doll;
 1 
Other top sites:   robertstrucking.com     balihf.com     tv-viewing-software.smartcode.com     radio-scouting.org.uk     handknittedtreasures.com     home.lcusd.net   
Recently processed sites:   increasemymonthlyincome.com     increasemysales.com     increasemysmallbusiness.com     increasemyspaceplaysandviews.wordpress.com     increase-my-speed.fix-kit.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9