SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

analytic.ru
Title: AnCom - Средства измерений связи. Средства передачи данных.
Description: home_d, xDSL анализатор, анализатор ВЧ-ЛЭП, тестер потоков E1, анализатор потоков E1, тестер потоков е1, анализатор потоков е1, анализатор качества передачи речи, анализатор NGN, анализатор VoIP, анализатор каналов ТЧ, анализатор PLC, модем, GSM, GPRS, EDGE, RS-485, RS-232C

Site: "analytic.ru"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: n na


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
Sample Organic Keywords
g 991.2
g 992.5
itu g.992.5
itu g.992.3
adsl itu
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Broadband-forum.org: Broadband Forum - Home

Keywords: test adsl; broadband forum; broadband; home broadband; forumtr; adsl test; telekom dsl; adsl router; dsl forum; shdsl;

Cisco.com: Cisco Systems, Inc

The Ross Global Academy gallery web page was maintained by Terrell Neuage and Lassina. See http://neuage.org and http://ournews.mobi for more.
Keywords: cisco; download software; ccie; business firewall software; ccnp; quad; cisco router; router; telepresence; networking products;

En.wikipedia.org: Wikipedia, the free encyclopedia

Keywords: facebook; gmail; g m a i l; google; s e x; sex; orkut; you tube; mortgage; orange;

Itu.int:

Keywords: itu; jvt; gilf; termite; investir; int; l'union; 00000; radiocommunication; itu t;

Networkworld.com: Network World

Network news, trend analysis, product testing and the industry’s most important blogs, all collected at the most popular network watering hole on the Internet
Keywords: network security; cisco; hp; h p; security; talktalk; server; servers; storage software company; microsoft;

Patton.com: VoIP at Patton: Routers, High Speed Internet, Ethernet Extenders, Remote Access Server

Voip at Patton. Your source for routers, high speed internet, ethernet extenders and remote access servers
Keywords: patton; voip router; ethernet repeater; fxo; voip gateway; patton fans; voip products; 2603; ethernet repeaters; voip routers;

Proscend.com: Proscend Communications Inc.

Keywords: g shdsl router; shdsl; atm router; g shdsl bis; atm routers; 2base; gshdsl; shdsl ntu; g 991.2; modem hdsl;

Tainet.net:

Keywords: tainet; g shdsl bis; system communication; ethernet over ac power; 336 trs;
 1 
Other top sites:   canadafutures.com     cms-cmck.com     acp.dadoo0.is.com     subtlearchitectures.blogspot.com     framedmovieposters.org     marsilios.com   
Recently processed sites:   drywallrepairservice.com     drywallrepairserviceinwestpalmbeachfl.com     dry-wall-repairs.sandertools18.com     drywall-repair-tips.blogspot.com     drywallrepairtool.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9