SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

bee-cigs.com
Title: Buy Cheep Cigarettes Online. Buying Tax Free Malboro cigarettes from $25.45
Description: Cheap cigarettes. Bee-Cigs.com offers you only fresh cigarettes of all most popular brands with fast shipping and cheap price.

Site: "bee-cigs.com"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: e ee


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
Sample Organic Keywords
dunhill carton
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Answers.yahoo.com: Yahoo! Answers - Home

Yahoo! Answers is a new way to find and share information. You can ask questions on any topic, get answers from real people, and share your insights and experience.
Keywords: yahoo answers; yahoo.fr; yahoo.es; who blocked me on msn; hotmail.fr; hotmail fr; pre owned porsche boxster; ich liebe dich; peugeot 106; sim only;

Cigarena.com: Cigarettes at Cigarena.com: Cheap cigarettes online. Marlboro cigarettes.

Cheap Cigarettes online from Cigarena.com Store offers discount cigarettes. $18-00 per carton for cheap Marlboro Cigarettes.
Keywords: davidoff black; who owns marlboro cigarettes; marlboro cigarettes catalog;

Cigoutlet.net: CIGoutlet.NET - Online Cigarettes Store. $20.50 for MARLBORO Red cigarettes per carton.

Discount Cigarettes and Cigars online, fresh and exquisitely flavored! The large variety of top brands ($ 20.50 for one carton - 200 Marlboro cigs) can satisfy even the most pretentious customer. You'll be amazed of our low prices and high quality tobacco products!
Keywords: marlboro; cigarettes; cigarette; cigarettes online; buy cigarettes online; online cigarettes; cheap cigarettes online; marlboro cigarettes; malboro; cigarette shop;

Dutyfreedepot.com:

Buy discounted Marlboro, Camel, Parliament and many other brand name cigarettes and spirits in our online duty-free store.
Keywords: duty free; dunhill cigarettes; duty free shop; duty free cigarettes; tax free cigarette; dutyfree; silk cut; duty free prices; van nelle; john player special;

Onesmoke.net: OneSmoke.net - cheap cigarettes store. Buy cheap Marlboro cigarettes online at discount price.

Cheap cigarettes store offers you a wide variety of Marlboro cigarettes, Camel cigarettes or Wibston cigarettes.
Keywords: davidoff one cigarettes;
 1 
Other top sites:   getglow.com     fatal-trip.blogspot.com     jackericgrossman.com     fashion-links.de     friia.com     tularosaunconcerted.co.cc   
Recently processed sites:   mcfarlaneandco.co.uk     mcfarlaneasphalt.com     mcfarlaneasphaltdrivewaypaving.com     mcfarlane-aviation.com     mcfarlaneaviation.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9