SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form
centurionseacadets.org
Title: Centurion's Home
Description:

Site: "centurionseacadets.org"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: e en


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon
Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
Sample Organic Keywords
rcscc falkland
rcscc
rcscc undaunted
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Ca.linkedin.com: Canada | LinkedIn

LinkedIn strengthens and extends your existing network of trusted contacts. LinkedIn is a networking tool that helps you discover inside connections to recommended job candidates, industry experts and business partners.
Keywords: sobika; mopera; réseau contact; spisar; deurwaarder; karpfen; ioana radu; coevorden; casais; roberto pimentel;

Dir.groups.yahoo.com: Yahoo! Groups - Join or create groups, clubs, forums & communities

Yahoo! Groups offers free mailing lists, photo & file sharing, group calendars and more. Discuss hot topics, share interests, join online communities.
Keywords: yahoo groups; yahoo groups; yahoo group; yahoo groups; yahoogroups; yahoogroups; yahoo groups; male feet; groups yahoo; groups.yahoo;

Falkland.org: Navy League of Canada - Ottawa Branch
Keywords: navy league of canada; rcscc falkland; rcscc;

Navyleague.ca: Oceans of Opportunity :: The Navy League of Canada
Keywords: navy canada; cadets canada; canada sea; canada navy; canada cadets; canada cadet; ashley muldoon; navy league awards; rcscc falkland; navy cic;

Twitter.com: Twitter: What are you doing?
Keywords: facebook; google; g m a i l; gmail; you tube; twitter; orkut; hotmail; expedia; gmail com;

Youtube.com: YouTube

Upload, tag, and share your videos worldwide on YouTube, and watch other user-submitted videos sorted by most recent, ... hours of video uploaded every ...
Keywords: you tube; google; youtube.com; youtube com; you; www youtube com; www.youtube.com; youtube videos; yotube; david bisbal;
 1 
Other top sites:   wieseandsons.com     missmissouriusa.com     clay.com     nidothreads.com     cubehotel.jp     parrottraining.com   
Recently processed sites:   blackfridayinwarnernewhampshire.wordpress.com     blackfridayipad.blackfridayreviewdeals.com     blackfridayiphonecameralensreplacement.cheapshopsnow.com     blackfridayipodclassic.blogspot.com     blackfridayjblspeaker.blogspot.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9