SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

csg.org
Title: The Council of State Governments
Description:

Site: "csg.org"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: s sg


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Columbusschoolforgirls.org: Columbus School for Girls: Home

Keywords: school girls; csg; girls school; columbus school; columbus schools; schools girls; school for girls; for girls; columbus school for girls; columbus ohio schools;

Csgdelivers.com: CSG Government Solutions > Home

Keywords: csg; project management solutions; health data management magazine; customer server; chicago system;

Csgllc.com: CSG Holdings LLC

CSG Holdings LLC is an independent, unbiased organization assisting individuals and institutions in the preservation and growth of their assets. CSG and its affiliates provide full-service investment consulting in addition to other related estate planning and risk-hedging services.
Keywords: csg; consulting services group; consulting service group; csg consulting; service consulting company; csg consultants;

Csgonline.org: Community Services Group > Home

Keywords: csg; community services; community services group; community service group; community service groups; service group; services group; group service; service community; services community;

Csgrp.com: Conservation Services Group (CSG) | Promoting Energy Efficiency and Renewable Energy Resources

Keywords: csg; conservation services; services group; energy efficiency jobs; service group; group service; customer contact centers; conservation services group; energy conservation services; steve cowell;

Csgwebsite.com: CSG Consultants, Inc.

CSG Consultants is a California based municipal consulting firm. Providing Building, Engineering, Construction Management, and IT services since 1991.
Keywords: csg consultants;

En.wikipedia.org: Wikipedia, the free encyclopedia

Keywords: facebook; gmail; g m a i l; google; s e x; sex; orkut; you tube; mortgage; orange;
 1 
Other top sites:   mascotcoins.com     womaninthe21stcentury.wordpress.com     sprixx.com     flaccidegostudios.spreadshirt.com     heartsandskulls.com     cincywarmline.org   
Recently processed sites:   fancymayhem.tumblr.com     fancymecandy.storenvy.com     fancymechanicalpencils.reviews4buyonline.com     fancymedicalscrubs.com     fancymegan.tumblr.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9