SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form
dailyacid.com
Title: Daily Acid
Description:

Site: "dailyacid.com"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: a ai


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon
Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

9gag.com: 9GAG - What The Fun!

Have her dress up as a ghost and you dress uup us Pacman. ... Dress up as superherous and stop at least one petty crime “ie. jaywalking, littering….” ...
Keywords: lorry transport; ccc; arale; ray; transformador; nijntje; nice kid; flowers for men; porta loo; coffee vendor;

Abcnews.go.com: ABCNews.com - Breaking news, politics, online news, world news, feature stories, celebrity interviews and more - ABC News

ABCNews.com is your breaking news resource for the Michael Jackson memorial, top stories, video, photos and blogs and special reports including politics, exclusive celebrity interviews and features on Good Morning America, World News, Nightline, 2020 and This Week with George Stephanopoulos.
Keywords: a b c; abc; abc news; news; money; bachelorette; gma; abc com; abc.com; abcnews;

Geekologie.com: Geekologie - Gadgets, Gizmos, and Awesome

Geekologie is website dedicated to the scientific study of gadgets, gizmos, and awesome.
Keywords: truffle shuffle; 1 and 1; ferrari 360; spiderman tattoo; google map directions; yahoo answers; hummers; drunk people; pedo; for the love of god;

Instructables.com: Instructables - Make, How To, and DIY

Instructables is the Biggest How To and DIY community where people make and share inspiring, entertaining, and useful projects, recipes, and hacks.
Keywords: ethernet splitter; how to make; how to make; cnc; jtag; how to put on a condom; zippo tricks; zippo tricks; shelf; how to kiss;

Theberry.com: theBERRY

World's First Female Humor Site
Keywords: jocelyn wildenstein; david gandy; rosa clara; the berry; men in speedos; 4 year old drummer; nail tattoo; samba dance video; weird tattoos; ashley olson;

Youtube.com: YouTube

Upload, tag, and share your videos worldwide on YouTube, and watch other user-submitted videos sorted by most recent, ... hours of video uploaded every ...
Keywords: you tube; google; youtube.com; youtube com; you; www youtube com; www.youtube.com; youtube videos; yotube; david bisbal;
 1 
Other top sites:   decoratemywedding.com     trustedwatch.biz     paymentedeliver.blog131.fc2.com     bareskintowel.com     studiobanana.org     californiacuts.org   
Recently processed sites:   kellerwilliamsgreenvillecentral.yourkwoffice.com     kellerwilliamshagerstown.com     kellerwilliamshenderson.yourkwoffice.com     kellerwilliamshilltop.com     kellerwilliamshoover.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9