SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form
dustbunny.com
Title: Welcome to Dustbunny!
Description: dustbunny.com is the home of Astronomy for Kids and A Journey in Time - a Morris Family history

Site: "dustbunny.com"
IP Address: 69.163.155.208
IP Location: United States

This site within Alpha Directory: u us


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon
Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Astropix.com: Catching the Light: Astrophotography by Jerry Lodriguss

Astrophotography Tips and Techniques
Keywords: astrophotography; trapezium; big dipper; m42; cassiopeia; sports photography; digital astrophotography; the big dipper; little dipper; m11;

Astro.wisc.edu:

Keywords: constellations; perseus; orion; stars; capella; sirius; aquila; pavo; vela; constellation;

Big-dipper.com: Grease Trap, Grease Interceptor & Oil Separator Systems for Commercial Kitchens and Restaurants - Big Dipper-Thermaco

Big Dipper-Thermaco is the leading separation technology company in the highly specialized field of oil and grease extraction from wastewater manufacturing grease traps, oil separators, grease interceptors and other grease removal products. Contact a Big Dipper-Thermaco engineer to learn more about how we can help you solve your grease and oil problems.
Keywords: big dipper; grease trap; grease traps; big dipper grease trap; commercial grease trap; grease separator; commercial grease traps; grease interceptor; thermaco; grease trap cleaning;

Bigdippericecream.com: Big Dipper Ice Cream, Missoula Montana

Handmade gourmet ice cream. Highlighting flavors and menu.
Keywords: big dipper; big ice cream; the big dipper; ice cream dipper; big icecream; the big dipper ice cream; big dipper ice cream parlor; big cream; big diper; ice cream dippers;

Earthsky.org: EarthSky.org - A Clear Voice for Science

The World's Top Scientists Heard 15 Million Times a Day
Keywords: sky com; tonight; sky com; perseids; star sky; star in the sky; star in the sky; stars in the sky; perseids; www sky com;

En.wikipedia.org: Wikipedia, the free encyclopedia
Keywords: facebook; gmail; g m a i l; google; s e x; sex; orkut; you tube; mortgage; orange;

Space.com: Learn More at Space.com. From Satellites to Stars, NASA information ...

Space.com provides information on everything Space - satellites, stars, astronomy, the Sun, planets, NASA and more. ... Complete coverage of NASA's Phoenix ...
Keywords: space; first direct; night sky; perseids; name a star; space com; firstdirect; pluto; eclipses; outer space;
 1 
Other top sites:   acorprofba.dlinkddns.com     kevinblissett.com     emdr.org.uk     gotessons.se     genevickers.com     cosdev.com   
Recently processed sites:   rosemarywest.com     rosemarywestphotography.com     rosemarywestteam.com     rosemarywhitepediatricservices.com     rosemarywilson2012.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9