SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form
folder.com
Title: Presentation Folders, Pocket Folders, Printed Folder, Folder Factory
Description: We have best selection of presentation folders and other products made by folders.com, custom made for your business since 1973. Quality is our business.

Site: "folder.com"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: o ol


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon
Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Codesector.com: Code Sector Products

Official site. Contains product information, support, and news.
Keywords: fast file copy; maverick; sector; copy files; file copy; voice call; address organizer; files copy; windows volume control; copy file;

En.wikipedia.org: Wikipedia, the free encyclopedia
Keywords: facebook; gmail; g m a i l; google; s e x; sex; orkut; you tube; mortgage; orange;

Folder.es: Folder.es
Keywords: papelerias;

Stclairsoft.com: St. Clair Software
Keywords: default folder; folder; clair; default folders; st claire; st. claire; st cl; screen catcher; st software; sleeper's;

Twitter.com: Twitter: What are you doing?
Keywords: facebook; google; g m a i l; gmail; you tube; twitter; orkut; hotmail; expedia; gmail com;

Webopedia.com: Webopedia: Online Computer Dictionary for Computer and Internet Terms and Definitions

An online computer dictionary and internet search engine for internet terms and technical support.
Keywords: internet; domain name; intranet; adsl; domain names; streaming; jpg; 3g; program; data;

Wisecleaner.com: Wise Registry Cleaner | Wise Disk Cleaner - Keep your PC at peak ...

Wise registry cleaner and Wise disk cleaner, helps you to automatically fix computer errors, improve computer speed and reclaim a large number of hard disk space.
Keywords: registry cleaner; cleaner; free registry cleaner; registry cleaner free; cleaner download; disk cleaner; wise; wise registry cleaner; disc cleaner; registry cleaner pro;
 1 
Other top sites:   bls.org     ilanver.in     robertstrucking.com     studiodimonticelli.com     peterd.org     homemadehostel.com   
Recently processed sites:   creekviewfarm.com     creekviewfarmenglishshepherds.com     creekviewfarm.net     creekviewfarms.com     creekviewfarms.net   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9