SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

gmmgs.com
Title: GREEN MOUNTAIN MEDICAL GAS SERVICES
Description: Medical Gas System Consulting, Training, Testing, Certification and Verification Since 1978

Site: "gmmgs.com"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: m mm


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
Sample Organic Keywords
asse 6010
gas installer training
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Asse-plumbing.org: ASSE - American Society of Sanitary Engineering

Keywords: asse; plumbing standards; yard hydrant; backflow device; backflow certification; american standard plumbing; yard hydrants; american society of safety engineers; seal trap; backflow test kits;

Awjohnson.com: AW Johnson & Associates

AW Johnson & Associates - Medical Gas Training & Welding Consultants
Keywords: medical gas training; medical gas installation; gas training courses; johnson & associates; gas installation training; nfpa 99 medical gas; nfpa 99 2005; pressure vessels piping; brazing course; asse 6010;

Certifiedmedgas.com: Certified Medical Gas Services

Certified Medical Gas Services - Inspection, Testing and Verification Services, Sales and Installation services, Preventative Maintenance Services, System Assessments, and Training and Consulting Services.
Keywords: medical gas services; asse 6010; medical gas installer; gas installation training; nfpa 99 medical gas;

Chxprogram.com: Compliant Healthcare Technologies, LLC CHT Medical Piped Gas System Testing and Compliance Services. CHxProgram

Medical Piped Gas System Testing and Compliance Services, Compliant Healthcare Technologies, LLC, World-class compliance for the changing world of healthcare. Compliance for Medical Piped Gas Systems. CHxProgram
Keywords: gas maintenance; compliant healthcare technologies; piped gas; asse 6010;

Medicalgasinfo.com: Server Status

Keywords: nfpa 99; medical gas fittings; gas manifolds; nfpa 99 2005; nfpa 99 medical gas; icfm vs scfm;

Plumbingzone.com: Plumbing Zone - Professional Plumbers Forum

Professional Plumbing Contractors Forum
Keywords: plumbers forum; plumber forum; sewer jetter; service majic; underfloor heating pipe; wirsbo plumbing; craftmaster water heater; plumbers success; trac pipe; pex crimper;

Wmgfrankmedgas.com: Medical Gas Services - Concord, NH - Inspections, Certification, Verification and Outlet Repair

William G. Frank Medical Gas Services, LLC is NH’s leading resource for annual testing and maintainance requirements on medical gas systems for hospitals and other medical facilities.
Keywords: medical gas jobs; medical gas services; concord outlets;
 1 
Other top sites:   inmobiliarialacant.com     ezekielswheelbikes.com     franciscagomez.com     alto-reste.com     debtcorp.com     mojokawasaki.com   
Recently processed sites:   deerparkconstruction.com     deer-park.co.uk     deerparkcountryclub.com     deerparkcountryhotel.co.uk     deerparkcriminaldefenselawyer.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9