SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

jakehook.com
Title: Jake Hook
Description: The official webpage for UK singer-songwriter Jake Hook. Find out the latest from his current projects, The Soldiers, Lexie Stobie, Elizabeth Marvelly, Blake, Julie Atherton and Beryl Marsden.

Site: "jakehook.com"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: a ak


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Answers.yahoo.com: Yahoo! Answers - Home

Yahoo! Answers is a new way to find and share information. You can ask questions on any topic, get answers from real people, and share your insights and experience.
Keywords: yahoo answers; yahoo.fr; yahoo.es; who blocked me on msn; hotmail.fr; hotmail fr; pre owned porsche boxster; ich liebe dich; peugeot 106; sim only;

Countrycentral.wordpress.com: Country Music Central

Keywords: private malone; soldier songs; riding with private malone; trace adkins arlington; music central; some gave all billy ray cyrus; christian kane more than i deserve; till the last shots fired; country music top 30; since you brought it up;

Elyrics.net: Song Lyrics

DAILY UPDATED! One of the largest, most accurate, browsable & searchable song lyrics source on the net, providing more than 200,000 lyrics from around 13,500 artists since 2000.
Keywords: holiday; thriller; lyrics; the climb; rooftops; best i ever had; animal i have become; new boyz; song; sweet dreams;

Songarea.com: Music Playlist, Music Codes for Myspace, Facebook, Friendster ...

Myspace Playlist, Music codes for your pages. Create your playlist and add it to Myspace, Facebook, Friendster, share it with friends, use your playlist as myspace music player.
Keywords: hannah montana songs; alvin and the chipmunks songs; miley cyrus songs; michael jackson songs; playlist; parody songs; chipmunks songs; akon songs; john cena song; nickelback songs;

Youtube.com: YouTube

Upload, tag, and share your videos worldwide on YouTube, and watch other user-submitted videos sorted by most recent, ... hours of video uploaded every ...
Keywords: you tube; google; youtube.com; youtube com; you; www youtube com; www.youtube.com; youtube videos; yotube; david bisbal;
 1 
Other top sites:   pingis.nu     getpanache.com     hzjuplrxr.ce.ms     howmedica.com     fritzspharmacy.com     thatsasome.com   
Recently processed sites:   castlehillscommunity.com     castlehillsdayspa.com     castlehillsdc.com.au     castlehillsdental.com     castlehillsfamilypractice.vpweb.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9