SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

jmacoracing.com
Title: The Online Home of Crate Late Model Driver, Jeff McGhee!
Description:

Site: "jmacoracing.com"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: m ma


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
Sample Organic Keywords
jeff mcghee
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Facebook.com: Welcome to Facebook! | Facebook

Facebook is a social utility that connects people with friends and others who work, study and live around them. People use Facebook to keep up with friends, upload an unlimited number of photos, post links and videos, and learn more about the people they meet.
Keywords: facebook; face; facebook.com; facebook com; www facebook com; www.facebook.com; fb; face book; g m a i l; www;

Linkedin.com: LinkedIn: Relationships Matter

LinkedIn strengthens and extends your existing network of trusted contacts. ... Stay informed about your contacts and industry. Find the people & knowledge you ...
Keywords: linkedin; credit mutuel; pages jaunes; la banque postale; linkedin; tiscali; pages jaunes; sahibinden; meetic; yves rocher;

Myspace.com: MySpace

Get Started On MySpace! Join for free, and view profiles, connect with others, blog, rank music, and much more!
Keywords: myspace; myspace com; myspace.com; my; m y; rihanna; www myspace com; www.myspace.com; meteo; bt;

Spokeo.com: People Search | White Pages | Find People | FREE!

People search engine and white pages finds phone, address, email, and photos. Find people for free.
Keywords: people search; find people; email search; reverse email; email lookup; people search white pages; search people; search for people; find people by email; search email;

Twitter.com: Twitter: What are you doing?

Keywords: facebook; google; g m a i l; gmail; you tube; twitter; orkut; hotmail; expedia; gmail com;

West.stanford.edu: Center for the Study of the North American West

Nov 20, 2008 ... The Bill Lane Center for the West is dedicated to advancing scholarly and public understanding of the past, present, and future of western ...
Keywords: vaqueros; bill lane; randmcnally; western enterprise; african american cowboys; phoenix desert; desert phoenix; 1 dime; canadian pacific railway; cattle industry;

Whitepages.com: WhitePages - Find People for Free and Connect with Confidence

Find email addresses, phone numbers, and area and zip codes for people and businesses.
Keywords: phone; reverse phone lookup; telephone; white pages; business search; phone number lookup; find people; phone book; people search; phone numbers;
 1 
Other top sites:   em-il-ie.com     debtcorp.com     bargemon.org     crohnsite.be     interactiuni.ro     softlab.ru   
Recently processed sites:   poway.myhomeimprovement.com     powaynewschieftain.myclassifiedmarketplace.com     powaynursery.com     poway.olx.com     powayoptometry.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9