SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form
kr021.k12.sd.us
Title: Kelly Riedell HOME
Description:

Site: "kr021.k12.sd.us"
IP Address: 206.176.52.172
IP Location: United States

This site within Alpha Directory: r r0


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon
Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Biology.about.com: Biology

The starting place for exploring Biology. Find information about human anatomy, cell anatomy, online dissections and much more.
Keywords: mitochondria; hand sanitizer; sanitizer; pons; hand sanitizers; stomach; allele; incomplete dominance; veins; aorta;

Biologyjunction.com: BiologyJunction
Keywords: fetal pig dissection; cell size; biology projects; clam dissection; ap biology labs; biology games; ph indicator; earthworm dissection; plant reproduction; campbell biology 7th edition;

Jdenuno.com: jdenuno
Keywords: ap biology; democritus atomic model; democritus atomic model; human muscle chart; muscle diagram; ap biology review; ap bio; sordaria; muscles diagram; leg muscles diagram;

Local.brookings.k12.sd.us: Brookings School District
Keywords: starfish anatomy; parts of an earthworm; ap bio lab 6; bobcat apparel; mitosis worksheets; earthworm parts; bird excretory system; bird excretory system; frog lab; lab 11 animal behavior;

Quia.com: Quia

Create your own educational games, quizzes, surveys, and web pages. Search millions of games and quizzes created by educators around the world.
Keywords: racconti erotici; quia; ser; shared; wer wird millionär; colores; avoir; spanish games; vetements; hangman;

Sciencegeek.net: ScienceGeek.net - Support for High School Science

Support for high school science courses, including chemistry, AP Chemistry, biology and physics. ScienceGeek.net is the website of Andy Allan, science instructor at El Diamante High School in Visalia, CA.
Keywords: chemistry review; phase diagram; valence electrons; ap chemistry; echem; chemistry powerpoints; printable periodic table; simple periodic table; alkanes; kinetic molecular theory;

Sciencereviewgames.com: Untitled Document
Keywords: genetics review; games review; geology games; chemistry games; living environment; review games; biology games; srg; earth science review; game science;

Serendip.brynmawr.edu: Serendip's Exchange
Keywords: sleep deprivation; sleepwalking; abortion pill; schizophrenia brain; human pheromones; praying mantis; sleepwalker; sleep deprivation effects; playground; blind spot;
 1 
Other top sites:   gulfcoast.travelhero.com     eiga.org     dryearwax.co.cc     amagosadefence.forumotion.net     temperformance.com     stjudemb.org   
Recently processed sites:   6955.bandcamp.com     6955villageparkway.midassanfrancisco.com     69.56.138.42     69.56.140.150     69.56.147.7   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9