SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

moazed.med.harvard.edu
Title: Welcome to the Moazed Lab
Description:

Site: "moazed.med.harvard.edu"
IP Address: 134.174.168.14
IP Location: United States

This site within Alpha Directory: o oa


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Atlasgeneticsoncology.org: The Atlas of Genetics and Cytogenetics in Oncology and Haematology

Jan 29, 2009 ... The Atlas of Genetics and Cytogenetics in Oncology and Haematology gives reviews on genes involved in cancer, leukemias, solid tumors, ...
Keywords: alk; eto; rela; transcription factors; cytogenetics; mll; bcr; 11 14; lpp; transcription factor;

Cell.com: Cell

Keywords: neuron; cancer cell; immunity; trends; structure; cells; stem cell; cell.com; current biology; the cell;

Columbia.edu: Columbia University in the City of New York

Keywords: columbia; columbia university; university; clio; kermit; kou; jstor; curp; sister; bee gees;

En.wikipedia.org: Wikipedia, the free encyclopedia

Keywords: facebook; gmail; g m a i l; google; s e x; sex; orkut; you tube; mortgage; orange;

Gs.washington.edu: UW Genome Sciences

Department of Genome Sciences at the University of Washington. Includes information about our doctoral program, faculty, courses, and seminars & events.
Keywords: phil green; villen; villen; combi; green p; philip green; dna isolation; genome science; claire king; william stafford;

Medical-dictionary.thefreedictionary.com: Medical Dictionary

Medical Dictionary is intended for use by healthcare consumers, students, and professionals as well as anyone who wants to keep up with the burgeoning array of terminology found in today’s medical news. By staying clear of jargon, the dictionary offers fast and concise information, whether the user is searching for a description of an over-the-counter or prescription medication, a medical abbrevi
Keywords: coeur; allo; astma; rheuma; miopia; opthamologist; puericulture; medical dictionary; sifilis; recessive trait;

Medterms.com:

Keywords: bid; medical dictionary; vagina; medical; virus; medical terminology; leucemia; side effects; stat; medial;

Nature.com: Nature Publishing Group : science journals, jobs, and information

Nature - the world's best science and medicine on your desktop
Keywords: nature; y; eye; medicine; my account; m y account; scientific american; leukemia; obesity; register;
 1 
Other top sites:   cosmos.ru     tonyrotella.com     risingsun.md.phonepagesinc.com     dfred.net     wieseandsons.com     matokulu.com   
Recently processed sites:   jewelrynavajo.com     jewelrynbeads.com     jewelrync.com     jewelry-necklace.buycheapr.com     jewelrynecklacesandpendants.info   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9