SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

nokiausers.net
Title: Nokia Users - Nokia Software, News, Forums, and Reviews!
Description: Connecting Nokia Users - Your portal for Software, News, Reviews, and Discussion regarding your Nokia mobile.

Site: "nokiausers.net"
IP Address: 209.197.127.132
IP Location: United States

This site within Alpha Directory: o ok


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Au.answers.yahoo.com: Yahoo!7 Answers - Ask Questions & Get Answers On Any Topic!

Ask questions and get answers from real people with Yahoo!7 Answers. The place to find answers to any question on any topic of discussion.
Keywords: commonwealth netbank; bloger; holden rodeo; mymaths; yahoo7; acheive; colourbond; et vous; lowest refinance; holden commodore;

Cellphoneforums.net: Cell Phone Forums - Your Cell Phone Source

Cell Phone Forums is community for cell phone enthusiasts. Active forum discussion about Cell Phones service providers and Cell Phone Manufacturers, including AT&T, Cingular, Verizon, Nextel, T-Mobile, Sprint, Nokia, LG, Motorola, Samsung, Sony Ericsson, Audiovox, Sanyo.
Keywords: vzwpix.com; vzwpix com; funformobile; vtext com; flycell; orange top up; contact service; sim card registration failed; vzwpix; good ringtones;

Community.giffgaff.com: The giffgaff community - The giffgaff community

giffgaff, the first people powered mobile phone network
Keywords: o2 top up voucher; icon setup; giffgaff; hotm mail; 02 voucher; kudo mobile; simcode; yout the best; you are not subscribed to a cellular data service; hullo mail;

Exchange.telstra.com.au: exchange.telstra.com.au - Telstra Exchange, Telstra Blog, Technology, Telecommunications, Broadband, Network, Telstra, Australia

The official corporate blog site for Telstra, designed to deliver points of interest, informed comment and an exchange of views on Telstra, the Australian telecommunications industry and broader technology issues.
Keywords: telstra com; telstra prepaid; telstra pre paid; telstra internet; telstra mobiles; telstra prices; foxtel broadband; foxtel prices; telstra au; telstra australia;

Forum.vodafone.co.uk: Vodaphone

Welcome to the Vodafone eForum This forum lets you discuss the technical aspects of our products, services and the mobile world at large. You can ask questions, find answers and ...
Keywords: vodafone forum; vodaphone co uk; vodaphone co uk; vodafone co uk; apn vodafone; gioogle; vodafone.co.uk; btopenworld email; vodafone sms gateway; hotmail co uk account;

Playingwithsid.blogspot.com: Playing With Sid

Keywords: thenmala; national audio; marillat; pidgin sounds; ralink wireless; ralink linux; arky; using transmission; gnome notification area; use transmission;
 1 
Other top sites:   dryearwax.co.cc     marvinshoop.com     techtutorials.net     e-fabre.com     adtcarpets.co.uk     trxworld.com   
Recently processed sites:   swiftcreekmill.com     swiftcreekmine.com     swiftcreekms.mychesterfieldschools.com     swiftcreekmusic.com     swiftcreeknursery.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9