SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

pcbplanet.com
Title: PCB Planet
Description:

Site: "pcbplanet.com"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: c cb


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
Sample Organic Keywords
pcb india
pcb in india
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Alibaba.com: Manufacturers, Suppliers, Exporters & Importers from the world's largest online B2B marketplace-Alibaba.com

Find quality Manufacturers, Suppliers, Exporters, Importers, Buyers, Wholesalers, Products and Trade Leads from our award-winning International Trade Site. Import & Export on alibaba.com
Keywords: alibaba; alibaba.com; servicios empresariales; used renault megane; secondhand bmw; wall brackets; www.alibaba.com; pat tester; glas vitrine; baby cot;

Ats.net:

Keywords: flexible pcbs; ats.net; sales and marketing presentation; ims pcb; pwb layout; birgit knoechl; jutta strohmaier; ims lighting; ipc printed circuit board; effegi elettronica;

Geniustechindia.com: PCB Design Service India Printed Circuit Board (PCB) Design Service Bureau PCB Design Delhi

Genius Tech India is an established organization in Delhi India Providing services for PCB design in Delhi India with 15 year of experience it become leading SMD PCB design Company in India.
Keywords: pcb india; pcb in india;

Ipcaindia.org: IPCA India

Keywords: ipc specifications; ipc specification; most sought after it certifications; pcb manufacturers in india; ip ca; pcb manufacturers india; pcb manufacturer india; manufacture of pcbs; china printed circuit association;

Pcbindia.com: PCBindia.com - An eMarket for Electronics manufacturing Industry.

Keywords: emarket; pcb india; pcb industry; electronic manufacturing industry; pcb in india; pcb manufacturers in india; electronics manufacturing industry; pcb manufacturer india; pcb manufacturer in india; pcb manufacturers india;
 1 
Other top sites:   menuspeller.com     orderyoungliving.com     teatree.org.au     vgsidgyssget.onlwihvheady.co.cc     tlcooljc.org     corporate-image-group.com   
Recently processed sites:   blackfriday-digitalcameradeals2012.blogspot.com     blackfridaydigitalcameraonsale.com     blackfridaydigitalcameraprinterdock.cheapshopsnow.com     blackfridaydigitalcamerasales.info     blackfridaydigitalcamerasales.us   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9