SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

photoconception.com
Title: PhotoConception ~ The official website of photographic artist Thomas Hodges
Description:

Site: "photoconception.com"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: h ho


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Absolutearts.com: absolutearts.com - Buy Contemporary Art - Art News - Artist Portfolios

absolutearts - Contemporary Art for sale - Art News for collectors, artists, museums and purchase Fine Art. Buy art from our selection of contemporary art with over 20,000 artists and art galleries.
Keywords: acrylic paintings; pencil drawings; messen; la barra; art drawings; artnews; charcoal drawings; etching art; pen drawings; puya;

En.wikipedia.org: Wikipedia, the free encyclopedia

Keywords: facebook; gmail; g m a i l; google; s e x; sex; orkut; you tube; mortgage; orange;

Facebook.com: Welcome to Facebook! | Facebook

Facebook is a social utility that connects people with friends and others who work, study and live around them. People use Facebook to keep up with friends, upload an unlimited number of photos, post links and videos, and learn more about the people they meet.
Keywords: facebook; face; facebook.com; facebook com; www facebook com; www.facebook.com; fb; face book; g m a i l; www;

Imdb.com: The Internet Movie Database (IMDb)

IMDb: The biggest, best, most award-winning movie site on the planet.
Keywords: imdb; xxx; imdb; imdb; cars; imdb; taylor lautner; face; imdb; m;

Jthlaw.com: J. Thomas Hodges, Attorney at Law

Keywords: tom hodges; thomas hodges;

Starwars.wikia.com: Wookieepedia, the Star Wars Wiki

Star Wars movies, characters, and spin-offs are catalogued in Wookieepedia, a comprehensive database that anyone can edit.
Keywords: star wars; yt; darth vader; darth maul; jizz; carbonite; human; jawa; star.wars.the.clone.wars; star wars the clone wars;

Tomhodges.com: Tom Hodges - Story - Conceptual - Sequential Artist

expanding the horizons of senior housing management
Keywords: tom hodges; thomas hodges; hodges; sequential tom; sequential artist;
 1 
Other top sites:   freesem.info     blog.sweetheartdarlin.com     replacementkitchen.org     haricotime.exblog.jp     modasuo.com     okmtrailers.com   
Recently processed sites:   franklyspeaking.toastmastersclubs.org     franklyspeakingtoastmasters.org     franklyspeakingtoo.blogspot.com     frankly-speaking.typepad.com     franklyspeakingvintagegreetings.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9