SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form
plymouthbulletin.com
Title: Home page of the Plymouth Owners Club Bulletin
Description: Since 1957 the Plymouth Owners have existed to preserve and promote the Plymouth Line of cars and trucks.

Site: "plymouthbulletin.com"
IP Address: 208.109.58.23
IP Location: United States

This site within Alpha Directory: l ly


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon
Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Allpar.com: Allpar has Dodge, Chrysler, Plymouth, and Jeep car, minivan, and truck information
Keywords: dodge charger; chrysler 300c; jeep grand cherokee; dodge caliber; dodge viper; jeep patriot; dodge trucks; charger; jeep cherokee; dodge avenger;

Auto.howstuffworks.com: Howstuffworks "Auto Channel"

The Auto Channel contains articles about everything from engine workings to classic cars. Learn about cars on the HowStuffWorks Auto Channel.
Keywords: auto; cars; car insurance policy; bugatti veyron; car finance; opel auto; auto opel; chevrolet impala; car washes; car financing;

Autos.yahoo.com: New car pictures, prices and reviews - Yahoo! Autos

See new car pictures, find out new car prices and read new car reviews on Yahoo! Autos. Compare cars and get a free price quote from dealers near you. Check out Kelley Blue Book values for used cars and find used car listings near you.
Keywords: auto; autos; bmw; used audi a4; toyota; mercedes benz; mercedes-benz; used cars bmw; used bmw; auto mercedes benz;

Cars.com: Buy New & Used Cars, Research Prices, Sell My Car, Find Auto Dealers

Search 2.6 million new & used car listings, price a new car, get a dealer quote, read expert reviews, or sell your car for thousands over trade-in.
Keywords: cars; used cars; auto; car; autos; cars.com; cars com; pre-owned; pre owned; used cars for sale;

Cars-on-line.com: Cars On line.com: Classic Cars For Sale

Cars On line.com: Classic Cars For Sale
Keywords: nova cars; project cars; mercedes benz for sale; cars online; 1963 impala; 1964 impala; 1966 impala; 1970 chevelle; classic cars for sale; 1932 ford;

Chrysler.com: Official Chrysler site - Autos, Cars, Minivans, SUVs, Convertibles ...

The Chrysler site is your source for Chrysler dealers, vehicles, offers, and programs. Research, compare, and shop Chrysler cars, minivans, SUVs, and more.
Keywords: chrysler; chrysler 300; chrysler 300c; chrysler crossfire; p t cruiser; pt cruiser; chrysler sebring; chrysler.com; chrysler pt cruiser; 300c;

En.wikipedia.org: Wikipedia, the free encyclopedia
Keywords: facebook; gmail; g m a i l; google; s e x; sex; orkut; you tube; mortgage; orange;

Motortrend.com: New Cars, Car Reviews & Prices, Used Cars for Sale, & Auto Shows at ...

Official Motor Trend magazine web site features used cars, road tests, new cars, concept cars, auto shows, and much more car buying information and help.
Keywords: bmw; new cars; mercedes benz; mercedes-benz; audi; chevrolet; toyota; bmw cars; cadillac; car cars;

Topspeed.com: Car News and reviews, videos, wallpapers, pictures, free games and more. - Top Speed

Car News and reviews, videos, wallpapers, pictures, free games and more. - Top Speed
Keywords: opel; mercedes; citroen; audi q7; renault; car games; mitsubishi lancer; audi; skoda; cars peugeot;
 1 
Other top sites:   retrostats.com     sdhomelenders.com     quintessential-player.software.informer.com     justarumor.com     schwingi.net     ezphonerecorder.sunshinesoftsolutions.com   
Recently processed sites:   epicwealthsystems.cashgiftingextreme.com     epicweapons.com     epic-wear.com     epicwear.com     epic.weather.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9