SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

shoreholders.com
Title: Lamp Holders & Lamp Sockets by Shore Holders Made in the USA
Description:

Site: "shoreholders.com"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: h ho


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Candelacorp.com: Candela Corporation | Call Us @ (800) 922-9226

Keywords: candela; candela corp; candella; candela lamps; candela corporation; candela com; candela lighting; candela lamp; aromat nais; aromat ballast;

Catalog.miniscience.com: Scientific Supplies, Educational Products, Industrial Materials

Keywords: hand counters; copper electrode; magnesium rod; culture tube; iodine solution; magnesium metal; copper electrodes; hand counter; carbon electrode; hand tally;

Ceclighting.com: CEC Industries is a global manufacturer

Keywords: cava ier; form 1039;

Ebay.com: eBay - New & used electronics, cars, apparel, collectibles, sporting goods & more at low prices

Buy and sell electronics, cars, clothing, apparel, collectibles, sporting goods, digital cameras, and everything else on eBay, the world's online marketplace. Sign up and begin to buy and sell - auction or buy it now - almost anything on eBay.com
Keywords: ebay; e-bay; e bay; ebay.com; ebay com; e; bay; www.ebay.com; www ebay com; e bay com;

Newark.com:

Electronic components distributor Newark offers semiconductors, passives, interconnects, electromechanical, power source, specialty products, test and measurement equipment
Keywords: newark; newark electronics; newark home; electronic components; dial indicator; panduit; newark.com; weidmuller; molex; newarkinone;

Pinballlife.com: pinballlife.com

Pinball parts and supplies.
Keywords: flipper williams; williams flipper; bally flipper; flipper parts; pinball life; coin door; williams pinball parts; simpsons pinball; pinball part; pinballlife;

Surplussales.com: Surplus Sales of Nebraska

Keywords: sma cable; merlin gerin; metal brackets; squirrel cage blower; blower fan; toggle switches; surplus equipment; teflon wire; sma female; current transformer;

Thomasnet.com: ThomasNet® - CNC Machining, Metal Stamping, Gaskets, Fasteners and other industrial products and services.

ThomasNet, is the most comprehensive resource for finding information on suppliers of industrial products and services in North America
Keywords: thomas; roofing sheets; cnc; security system supplier; company register; metal fabricators; manufacturers; sheet metal fabricators; manufacturer; injection molded plastics;

Usterminals.com: Home Page

Keywords: insulated terminals; american electronic components; military terminals; miniature lamp sockets; american electronic component; american electric components; american electronics components;
 1 
Other top sites:   blog.crewest.com     wap.www.my-symbian.com     nationalrcfl.org     brothersoft.com-stats.domainrip.com     weissgold.ca     templates.haleymail.com   
Recently processed sites:   katadynminiceramicwaterfilter.n4z.gm9.com     katadyn-mk6.buycheapr.com     katadyn.netfirms.com     katadynngo.com     katadyn-pocket.compare99.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9