SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

staleycom.com
Title: Motorola Two Way Radio Dealer Ohio West Virginia Pennsylvania Staley Communication, Inc.
Description: Staley Communication specializes in the sales and service of wireless communication products and is an authorized Motorola two-way radio dealer and service station.

Site: "staleycom.com"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: t ta


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Aliexpress.com: Wholesale - Buy Products Online from China Wholesalers at Aliexpress.com

Find Quality Wholesalers, Suppliers, Manufacturers, Buyers and Products from Our Award-Winning International Trade Site. Wholesale Products from China Wholesalers at Aliexpress.com.
Keywords: laptops direct; petrol brush cutter; mobile phones direct; t0715; laptop trolley; lambdasonde; hawaiian fancy dress; fitness lounge; sleigh cot; laptop factory outlet;

Amazon.com: Amazon.com: Online Shopping for Electronics, Apparel, Computers, Books ...

Online shopping from the earth's biggest selection of books, magazines, music, DVDs, videos, electronics, computers, software, apparel & accessories, shoes, ...
Keywords: amazon; amazon com; amazon.com; books for sale; porno; corriere della sera; printers; laptop computers; mp3 player; iphone;

Bestbuy.com: Best Buy

Best Buy's online source for electronics, televisions, DVD players, home audio, ... Shop Best Buy with Confidence. Buy online pick up in store. Reward Zone® ...
Keywords: laptops; laptop computers; printers; best buy; laptop; digital cameras; external hard drive; desktop computers; speakers; bestbuy;

Buytwowayradios.com: Buy Two Way Radios - Lowest 2 Way Radio Prices Anywhere!

Buy Two Way Radios - Your source for both business radios and personal FRS / GMRS 2 way radios. Offers two way radios from BlackBox, Cobra, Garmin, Icom, Kenwood, Midland, Motorola, and Uniden.
Keywords: two way radios; two way radio; 2 way radios; 2 way radio; 2way radios; radios two way; twoway radios; two radios; radio 2 way; two way radios headsets;

Cabelas.com: Cabela's: Cabela's Official Website - Quality Hunting, Fishing, Camping and Outdoor Gear at competitive prices.

Quality Hunting, Fishing, Camping and Outdoor Gear at competitive prices.
Keywords: cabelas; hunting; camping; cabelas.com; cabelas com; cabellas; cabela's; sporting goods; fishing; cabala;

Cobra.com: Cobra Electronics Corporation

Cobra Electronics is known the world over as a manufacturer of superior quality communications and electronic equipment.
Keywords: cobra; c b radio; cb radio; cobra radar detector; cobra radar detectors; cobra two way radios; cobra radios; cb radios; cobra 2 way radios; radar detector;

Motorola.com: Home - Motorola USA

Motorola is known around the world for innovation in communications. ... Defeat the noise with Motorola Bluetooth® Headsets. EXPERIENCE IT. MOTOPURE™ H12 ...
Keywords: motorola; moto; motorola v3; motorola mobile phones; motorola radio; droid; motorola radios; milestone; backflip; motorola cell phones;

Rei.com: The REI Winter Sale Through 11/29: Great Deals on Holiday Gifts, Outdoor Gear, Equipment and Clothing for Skiing, Snowboarding & More

At REI, you'll find the great holiday gifts of gear, equipment and clothing you need for outdoor adventures. Save on outdoor gear and clothing for camping and hiking, cycling, climbing, kayaking, skiing, snowboarding and many more outdoor activities. 100% satisfaction guaranteed.
Keywords: camping; sleeping bags; sleeping bag; rei; tents; outlet; two way radios; cycling shoes; kayaks; novara;

Techwholesale.com: Two-Way Radios | Motorola Radios | Kenwood Radios | Business Radios | Walkie Talkies

"FREE SHIPPING & GUARANTEED…”Absolutely the Lowest Prices Anywhere on Two Way Radios, Walkie Talkies, Motorola Radios, Kenwood Radios, Business Radios - Guaranteed.
Keywords: two way radios; walkie talkie; walkie talkies; 2 way radios; two way radio; motorola radios; 2 way radio; motorola two way radios; walkie talkie radios; handheld two way radios;
 1 
Other top sites:   sears-automotive-1.blogspot.com     ir-aiful.com     lauraromano.net     countrysidehomesva.com     womaninthe21stcentury.wordpress.com     mmea-maryland.org   
Recently processed sites:   blackfridaygarminnmapslifetimemapupdi.blogspot.com     blackfridaygarminnuvigps.biggerdailydeals.com     blackfridaygasgrillsdeals.3owl.com     blackfridaygashs.wordpress.com     blackfridaygbldy.wordpress.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9