SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form
submarinepens.com
Title: index
Description:

Site: "submarinepens.com"
IP Address:
IP Location: Unknown IP

This site within Alpha Directory: u ub


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon
Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
Sample Organic Keywords
india pens
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

Cellopens.com: Cello Writing
Keywords: cello writing; india pens; cello pin point; escolar paper brasil;

Flipkart.com: Flipkart.com: Buy Books Online @ Book Store in India: Online Bookstore

Bookstore to buy books online. Book store with Free Shipping in India. Best book store in India to buy books online. Purchase books online.
Keywords: banen; carrera universal; hajo banzhaf; bose electronics; shantaram; obbligazioni; signification des reves; bitesize ks3; sqa past papers; strategic management of technology and innovation;

Lincpen.com: Exporter of Ball Pen, Stationery Manufacturers Suppliers, Pen Manufacturer in India.

Linc pen - One of India's leading manufacturers and exporters of ball pens, gel pens and all other Stationery Suppliers. Find the Stationery Manufacturers, Ball pens manufacturer as well as exporter of India from www.lincpen.com.
Keywords: india pens; india pen; penlink; ball pen manufacturers; product asp catid; product asp catid; pen stationary; pen manufacturing process;

Luxorpen.com: Luxor : Writing Instruments, Pens, Marker
Keywords: www luxor com; luxor in; india pens; luxor writing instruments; at luxar; for luxar; in luxar;

Reynolds-india.com: Reynolds
Keywords: india pens; india pen;

Sticpens.com: Welcome to Stic Pens
Keywords: stic pen; india pens;
 1 
Other top sites:   neb-rod-custom.com     nitrorc.com     thetitlepartners.com     bobdavisart.com     efragz.net     ilanver.in   
Recently processed sites:   oscardelarentasimplysweetchemise.info     oscardelarentasleepwear.bizrate.com     oscardelarenta.smarter.com     oscar-de-la-renta.stylefavs.com     oscardelarenta.stylefavs.com   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9