SERP Trends
SERPTrends Sites Directory
* if you want your list your site in our directory, contact us through feedback form

vaderstad.com
Title: Väderstad-Verken AB
Description: « Väderstad a leading company in soil management and drilling » ; « Väderstad, leader en machines de travail du sol et de semis » ; « Väderstad, ett ledande företag inom jordbearbetning och sådd » ; « Väderstad yra pirmaujanti žemes dirbimo technikos ir sejamuju gamintoja » ; « Das Unternehmen Väderstad ist ein Spezialist in den Bereichen Bodenbearbeitung und Sätechnik. »

Site: "vaderstad.com"
IP Address: 194.68.222.60
IP Location: Sweden

This site within Alpha Directory: a ad


SERPTrends extensions for Firefox and Chrome show whether the website moved up, down in search engine, just appeared or hasn't moved at all. It also shows how many positions the website gained or lost compare to search you performed previous day.
SERPTrends works for all major search engines (Google, Yahoo, Bing).
SERTTrends is a very useful tool for webmaster, site owners or anybody else who is interested in website positions. Download an extenstion and see for yourself how powerful and easy to use our extensions are.

Install SERPTrends securely from Mozilla and Chrome websites. Learn more about our addon

Advertisements
Besides powerful extenstions for Firefox and Chrome SERPTrends offers a lot of useful information about websites. We're constantly working on delivering new usefult features to you, so you always find something new.
In this section you can see some of ads which show in search engines for this website. This information is very useful, if you thinking to advertise your website. We suggest you first come to SERPTrends and research what your competitors write in their ads.
Keywords
In this section your find top 10 Ad Keywords and Organic Keywords.
Ad Keywords is a list of keywords which you can search on Google and see ads for this domain. This is again is very important information to look at if you starting to advertise in AdWords. It's important to know which keywords your competitors use.
Organic keywords is a list of non-paid keywords you can search on Google and find this domain. This together with ad keywords make a better picture of current website perfomance.
Sample Ad Keywords
 
Unfortunately, now we provide stats only for first 10 keywords per site, but we are hoping to increase this number in the future.

En.wikipedia.org: Wikipedia, the free encyclopedia

Keywords: facebook; gmail; g m a i l; google; s e x; sex; orkut; you tube; mortgage; orange;

En.wiktionary.org: Wiktionary, the free dictionary

Keywords: abogado; avocat; abogado; unterhaltung; booking; ospedale; avis; vollzeit; seks; discoteca;

Linkedin.com: LinkedIn: Relationships Matter

LinkedIn strengthens and extends your existing network of trusted contacts. ... Stay informed about your contacts and industry. Find the people & knowledge you ...
Keywords: linkedin; credit mutuel; pages jaunes; la banque postale; linkedin; tiscali; pages jaunes; sahibinden; meetic; yves rocher;

Nrk.no: Nyheter, tv og radio fra Norge og hele verden - NRK.no

NRK.no er Norges største tilbud på nett: nyheter fra Norge og verden, lokalnyheter, radio- og tv-program, podcast, vær, helse-, kultur-, underholdning-, humor- og debattstoff.
Keywords: linus i svingen; russekort; nyheter; brennpunkt; trafikk; morsomme; musikk; porn eskimo; lisens; leasing av bil;

Skriftlig.no: Skriftlig.no » Få det skriftlig

Keywords: skriftlig;

Soundcloud.com: Welcome - SoundCloud

Keywords: vuelo; hotmail.fr; hotmail fr; gmx.de; cadena ser; ordinateur; oriflame; strichcode; laminat; robyn;

Starwars.wikia.com: Wookieepedia, the Star Wars Wiki

Star Wars movies, characters, and spin-offs are catalogued in Wookieepedia, a comprehensive database that anyone can edit.
Keywords: star wars; yt; darth vader; darth maul; jizz; carbonite; human; jawa; star.wars.the.clone.wars; star wars the clone wars;

Tekniskaverken.se: Tekniska Verken - Tekniska Verken erbjuder el, elnät, vatten, avfallshantering, värme, kyla, optofiber, biogas & markprojektering

Tekniska Verken erbjuder el, elnät, vatten, avfallshantering, värme, kyla, optofiber, biogas & markprojektering
Keywords: tekniska verken; verken; vattenkraftverk; tekniska; om oss;
 1 
Other top sites:   ethernetnetworks.org     templates.haleymail.com     tcfexpressreviews.co.cc     streamyourchurch.com     verizon.epixhd.com     ezekielswheelbikes.com   
Recently processed sites:   blackfridaydigitalcameraonsale.com     blackfridaydigitalcameraprinterdock.cheapshopsnow.com     blackfridaydigitalcamerasales.info     blackfridaydigitalcamerasales.us     blackfridaydigitalcameras.info   
Sites alpha directory:  a b c d e f g h i j k l m l o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9